RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized protein YniD Amino Acid Sequence


Size: 35

Fasta

 

>uncharacterized protein YniD E. coli K12. Version NC_000913.3 GI:556503834
MPTKRFDKKHWKMVVVLLAICGAMLLLRWAAMIWG
              
                            

Download fasta file
RegulonDB