RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized protein YobH Amino Acid Sequence


Size: 79

Fasta

 

>protein YobH E. coli K12. Version NC_000913.3 GI:556503834
MRFIIRTVMLIALVWIGLLLSGYGVLIGSKENAAGLGLQCTYLTARGTSTVQYLHTKSGF
LGITDCPLLRKSNIVVDNG
              
                            

Download fasta file
RegulonDB