RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-44 prophage; putative uncharacterized protein YoeF Amino Acid Sequence


Size: 118

Fasta

 

>CP4-44 prophage; putative uncharacterized protein YoeF E. coli K12. Version NC_000913.3 GI:556503834
MAGVRQHGWRAIPAVCSEYGADTLPDRYRSDGRCLLFWQQAGISALKQELEVKTPYRAMN
HPVIGVVTKADLASMEQISLVKSWLREAGAHNVLVTSAVNNNGVTELFALLHTEEGCC
              
                            

Download fasta file
RegulonDB