RegulonDB RegulonDB 11.1: Amino acid Sequence
undecaprenyl-phosphate-α-L-Ara4N flippase - ArnE subunit Amino Acid Sequence


Size: 111

Fasta

 

>undecaprenyl-phosphate-α-L-Ara4N flippase - ArnE subunit E. coli K12. Version NC_000913.3 GI:556503834
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN
VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
              
                            

Download fasta file
RegulonDB