RegulonDB RegulonDB 10.9: Amino acid Sequence
UPF0370 protein YpfN Amino Acid Sequence


Size: 66

Fasta

 

>UPF0370 protein YpfN E. coli K12. Version NC_000913.3 GI:556503834
MDWLAKYWWILVIVFLVGVLLNVIKDLKRVDHKKFLANKPELPPHRDFNDKWDDDDDWPK
KDQPKK
              
                            

Download fasta file
RegulonDB