RegulonDB RegulonDB 10.9: Amino acid Sequence
putative metal-chelating domain-containing protein YeiW Amino Acid Sequence


Size: 84

Fasta

 

>PF03692 putative metal-chelating domain-containing protein YeiW E. coli K12. Version NC_000913.3 GI:556503834
MECRPGCGACCTAPSISSPIPGMPDGKPANTPCIQLDEQQRCKIFTSPLRPKVCAGLQAS
AEMCGNSRQQAMTWLIDLEMLTAP
              
                            

Download fasta file
RegulonDB