RegulonDB RegulonDB 11.1: Amino acid Sequence
uncharacterized protein YmiA Amino Acid Sequence


Size: 46

Fasta

 

>uncharacterized protein YmiA E. coli K12. Version NC_000913.3 GI:556503834
MRLAMPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG
              
                            

Download fasta file
RegulonDB