RegulonDB RegulonDB 10.9: Amino acid Sequence
InsAB' transposase Amino Acid Sequence


Size: 232

Fasta

 

>InsAB' transposase E. coli K12. Version NC_000913.3 GI:556503834
VASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA
MNGVGCRATARIMGVGLNTILRHLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSR
QRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLH
VISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ
              
                            

Download fasta file
RegulonDB