RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; DUF3950 domain-containing protein YlcI Amino Acid Sequence


Size: 64

Fasta

 

>DLP12 prophage; DUF3950 domain-containing protein YlcI E. coli K12. Version NC_000913.3 GI:556503834
MSTKNRTRRTTTRNIRFPNQMIEQINIALEQKGSGNFSAWVIEACRRRLTSEKRAYTSIK
SDEE
              
                            

Download fasta file
RegulonDB