RegulonDB RegulonDB 11.0: Amino acid Sequence
UPF0509 family protein YciZ Amino Acid Sequence


Size: 57

Fasta

 

>UPF0509 protein YciZ E. coli K12. Version NC_000913.3 GI:556503834
MSEFDAQRVAERIDIVLDILVAGDYHSAIHNLEILKAELLRQVAESTPDIPKAPWEI
              
                            

Download fasta file
RegulonDB