RegulonDB RegulonDB 11.0: Amino acid Sequence
uncharacterized protein YojO Amino Acid Sequence


Size: 54

Fasta

 

>uncharacterized protein YojO E. coli K12. Version NC_000913.3 GI:556503834
MHTPIGVKPVAGSKEWREAWQKRAFAHISNGYKYIYIAIDSPEIFLLVCSLIRI
              
                            

Download fasta file
RegulonDB