RegulonDB RegulonDB 10.9: Amino acid Sequence
hypothetical protein YgdT Amino Acid Sequence


Size: 48

Fasta

 

>hypothetical protein YgdT E. coli K12. Version NC_000913.3 GI:556503834
MLSTESWDNCEKPPLLFPFTALTCDETPVFSGSVLNLVAHSVDKYGIG
              
                            

Download fasta file
RegulonDB