RegulonDB RegulonDB 10.9: Amino acid Sequence
PtsG glucose transporter inhibitor Amino Acid Sequence


Size: 43

Fasta

 

>putative inhibitor of the PtsG glucose transporter E. coli K12. Version NC_000913.3 GI:556503834
MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES
              
                            

Download fasta file
RegulonDB