RegulonDB RegulonDB 11.0: Amino acid Sequence
IS150 protein InsAB Amino Acid Sequence


Size: 455

Fasta

 

>IS150 protein InsAB E. coli K12. Version NC_000913.3 GI:556503834
MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVALYEKHGEKGLIPKPKG
VSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVYEERGEAGLRALKIGTK
RNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKKAESLSSSHEKVKVLNEL
RQFYPLDELLRAAEIPRSTFYYHLKALSKPDKYADVKKRISEIYHENRGRYGYRRVTLSL
HREGKQINHKAVQRLMGTLSLKAAIKVKRYRSYRGEVGQTAPNVLQRDFKATRPNEKWVT
DVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHS
DQGWQYRMRRYQNILKEHGIKQSMSRKGNCLDNAVVECFFGTLKSECFYLDEFSNISELK
DAVTEYIEYYNSRRISLKLKGLTPIEYRNQTYMPR
              
                            

Download fasta file
RegulonDB