RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized membrane protein YkgR Amino Acid Sequence


Size: 33

Fasta

 

>uncharacterized membrane protein YkgR E. coli K12. Version NC_000913.3 GI:556503834
MKENKVQQISHKLINIVVFVAIVEYAYLFLHFY
              
                            

Download fasta file
RegulonDB