RegulonDB RegulonDB 10.10: Amino acid Sequence
heat shock-induced protein GndA Amino Acid Sequence


Size: 54

Fasta

 

>heat shock-induced protein GndA E. coli K12. Version NC_000913.3 GI:556503834
MLLLIPSNHISIKETSSLMVVTPSSRTLFVVIVSFQQRALTSSVPVFLAVKRGR
              
                            

Download fasta file
RegulonDB