RegulonDB RegulonDB 10.9: Amino acid Sequence
phage replication protein Amino Acid Sequence


Size: 77

Fasta

 

>phage replication protein E. coli K12. Version NC_000913.3 GI:556503834
MSTKLTGYVWDGCAASGMKLSSVAIMARLADFSNDEGVCWPSIETIARQIGAGMSTVRTA
IARLEAEGWLTRKARRQ
              
                            

Download fasta file
RegulonDB