RegulonDB RegulonDB 10.8: Amino acid Sequence
protein YmgM Amino Acid Sequence


Size: 67

Fasta

 

>protein YmgM E. coli K12. Version NC_000913.3 GI:556503834
MDDKQLQAQAAFSKASQPAIDASLNLRFSFLFSHPYANLQHFIIFFLGHRPDHPGKLYLV
TDNRCRA
              
                            

Download fasta file
RegulonDB