RegulonDB RegulonDB 10.9: Amino acid Sequence
protein YncO Amino Acid Sequence


Size: 61

Fasta

 

>protein YncO E. coli K12. Version NC_000913.3 GI:556503834
MIYITIFMILPCPVPCSHVFLYVFYIFLFLVLFIMTIYQSSQKLHFSNCYHNNQHHNSLH
N
              
                            

Download fasta file
RegulonDB