RegulonDB RegulonDB 10.9: Amino acid Sequence
putative translational regulatory protein ArgL Amino Acid Sequence


Size: 31

Fasta

 

>putative translational regulatory protein ArgL E. coli K12. Version NC_000913.3 GI:556503834
MNNYTYKVNFNSISGVRHARIKCPIYTKNTF
              
                            

Download fasta file
RegulonDB